CABS-dock: af96dfa98647ab0

Project name: af96dfa98647ab0

Status: done

submitted: 2024-07-15 08:27:04, status changed: 2024-07-15 10:31:33

Project settings

Protein sequence(s)	SFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKLCPMNRYSAQKQFWKASTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFLEHHH input pdb
Peptide sequence	CACA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	49.3349	2.41208	14.841	119
cluster_2.pdb ( medoid)	38.3715	6.46312	28.3862	248
cluster_3.pdb ( medoid)	27.82	4.38533	17.2488	122
cluster_4.pdb ( medoid)	21.311	5.49012	28.8051	117
cluster_5.pdb ( medoid)	17.1242	3.73741	14.4958	64
cluster_6.pdb ( medoid)	14.5231	6.81671	22.5996	99
cluster_7.pdb ( medoid)	8.81392	11.0053	38.4113	97
cluster_8.pdb ( medoid)	7.40829	4.45447	7.84044	33
cluster_9.pdb ( medoid)	5.37046	10.2412	21.6396	55
cluster_10.pdb ( medoid)	4.54996	10.11	28.6339	46