Project name: afe4305a1d7474a

Status: running

submitted: 2026-03-16 22:34:46, status changed: 2026-03-16 22:39:43

Project settings
Protein sequence(s) MTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTPMTSKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP input pdb
Peptide sequence WGWSLSHGYQVK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCC
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue