Project name: 2O2F-GLPFHP

Status: done

submitted: 2025-08-25 08:31:47, status changed: 2025-08-25 10:38:24

Project settings
Protein sequence(s) GYDNREIVMKYIHYKLSQRGYEWDEVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP input pdb
Peptide sequence GLPFHP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.2934 5.05061 16.3371 153
cluster_2.pdb ( medoid) 23.3977 8.3769 30.2094 196
cluster_3.pdb ( medoid) 12.9083 8.909 29.355 115
cluster_4.pdb ( medoid) 10.0078 8.29355 25.4496 83
cluster_5.pdb ( medoid) 9.43475 11.2351 30.6021 106
cluster_6.pdb ( medoid) 8.53027 11.8402 33.9165 101
cluster_7.pdb ( medoid) 7.00667 10.1332 23.5738 71
cluster_8.pdb ( medoid) 6.57831 11.7051 29.5501 77
cluster_9.pdb ( medoid) 5.99837 8.16888 20.4621 49
cluster_10.pdb ( medoid) 5.58771 8.76924 21.038 49