CABS-dock: 2O2F-GLPFHP

Project name: 2O2F-GLPFHP

Status: done

submitted: 2025-08-25 08:31:47, status changed: 2025-08-25 10:38:24

Project settings

Protein sequence(s)	GYDNREIVMKYIHYKLSQRGYEWDEVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGP input pdb
Peptide sequence	GLPFHP
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.2934	5.05061	16.3371	153
cluster_2.pdb ( medoid)	23.3977	8.3769	30.2094	196
cluster_3.pdb ( medoid)	12.9083	8.909	29.355	115
cluster_4.pdb ( medoid)	10.0078	8.29355	25.4496	83
cluster_5.pdb ( medoid)	9.43475	11.2351	30.6021	106
cluster_6.pdb ( medoid)	8.53027	11.8402	33.9165	101
cluster_7.pdb ( medoid)	7.00667	10.1332	23.5738	71
cluster_8.pdb ( medoid)	6.57831	11.7051	29.5501	77
cluster_9.pdb ( medoid)	5.99837	8.16888	20.4621	49
cluster_10.pdb ( medoid)	5.58771	8.76924	21.038	49