CABS-dock: b0a1159c8ad1b6c

Project name: b0a1159c8ad1b6c

Status: done

submitted: 2026-03-16 08:42:40, status changed: 2026-03-17 01:32:01

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRRVQVFGSNTYRRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.3456	3.38876	24.9978	113
cluster_2.pdb ( medoid)	19.1285	5.80287	23.8061	111
cluster_3.pdb ( medoid)	18.4973	6.54148	46.4367	121
cluster_4.pdb ( medoid)	16.7176	9.86984	24.3431	165
cluster_5.pdb ( medoid)	10.2283	13.2965	30.9174	136
cluster_6.pdb ( medoid)	8.51496	12.801	27.8965	109
cluster_7.pdb ( medoid)	5.73062	18.3226	39.9308	105
cluster_8.pdb ( medoid)	5.58013	9.31877	20.162	52
cluster_9.pdb ( medoid)	3.45786	15.6166	35.2029	54
cluster_10.pdb ( medoid)	2.27682	14.9331	31.4456	34