Project name: DYTNSQWRSL-YW

Status: done

submitted: 2026-07-16 04:05:54, status changed: 2026-07-16 06:17:02
Project settings
Protein sequence(s) GTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS input pdb
Peptide sequence DYTNSQWRSL
Simulation mc cycles50
Peptide secondary structure psipred CCCHHCCCCC
Contact information
267:A 3:PEP 8.0 1.0
298:A 5:PEP 8.0 1.0
317:A 7:PEP 8.0 1.0
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 
Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 48.0107 2.52027 7.34346 121
cluster_2.pdb ( medoid) 38.8593 3.39687 15.968 132
cluster_3.pdb ( medoid) 37.4244 3.71416 8.9861 139
cluster_4.pdb ( medoid) 33.1804 4.85226 10.7315 161
cluster_5.pdb ( medoid) 30.9907 2.58142 4.93717 80
cluster_6.pdb ( medoid) 28.5239 3.78629 7.6985 108
cluster_7.pdb ( medoid) 18.0691 5.03621 13.604 91
cluster_8.pdb ( medoid) 15.2359 3.87244 6.91202 59
cluster_9.pdb ( medoid) 13.1639 3.79826 7.14851 50
cluster_10.pdb ( medoid) 12.3381 4.78194 9.86582 59

 
Laboratory of Computational Biology, 2020