CABS-dock: 1XQ8-IP-flex-2

Project name: 1XQ8-IP-flex-2

Status: done

submitted: 2026-07-27 08:41:32, status changed: 2026-07-27 10:37:30

Project settings

Protein sequence(s)

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb

Peptide sequence

TTDHISAAGPW

Simulation mc cycles

Peptide secondary structure psipred

CCCCCCCCCCC

Contact information

93:A 1:PEP

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.5671	5.21914	26.6154	123
cluster_2.pdb ( medoid)	14.0659	8.38911	34.7659	118
cluster_3.pdb ( medoid)	11.0823	7.76009	23.6062	86
cluster_4.pdb ( medoid)	9.88659	10.9239	37.5281	108
cluster_5.pdb ( medoid)	7.63478	17.5513	51.9477	134
cluster_6.pdb ( medoid)	6.86823	12.8126	29.8416	88
cluster_7.pdb ( medoid)	6.24401	14.2537	45.8306	89
cluster_8.pdb ( medoid)	3.56145	17.1278	40.4902	61
cluster_9.pdb ( medoid)	3.16684	19.5779	44.8461	62
cluster_10.pdb ( medoid)	3.13677	18.8092	44.35	59