CABS-dock: M4DN1

Project name: M4DN1_UPPS

Status: done

submitted: 2026-06-10 05:56:30, status changed: 2026-06-10 09:35:22

Project settings

Protein sequence(s)	KLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE input pdb
Peptide sequence	APFC
Simulation mc cycles	50
Peptide secondary structure psipred	CCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	156.912	0.599063	6.64012	94
cluster_2.pdb ( medoid)	45.6879	6.17231	24.4985	282
cluster_3.pdb ( medoid)	17.2975	6.24366	33.118	108
cluster_4.pdb ( medoid)	15.0827	3.24875	22.1108	49
cluster_5.pdb ( medoid)	14.4254	5.61508	31.4725	81
cluster_6.pdb ( medoid)	7.04454	10.2207	31.5171	72
cluster_7.pdb ( medoid)	6.94238	11.9556	37.9692	83
cluster_8.pdb ( medoid)	5.53759	19.3225	44.1489	107
cluster_9.pdb ( medoid)	4.60979	12.7988	32.3253	59
cluster_10.pdb ( medoid)	3.78961	17.1522	36.8108	65