CABS-dock: b17f898304070df

Project name: b17f898304070df

Status: done

submitted: 2025-06-23 10:54:52, status changed: 2025-06-23 12:25:10

Project settings

Protein sequence(s)

SCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFC input pdb

Peptide sequence

RRKKAAVALLPAVLLALLAP

Simulation mc cycles

Peptide secondary structure psipred

CCHHHHHHHHHHHHHHHHCC

Unlikely to bind regions

107:A - 99:A

117:A - 168:A

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	28.3116	8.68902	29.4627	246
cluster_2.pdb ( medoid)	26.0414	3.14883	16.5687	82
cluster_3.pdb ( medoid)	16.7581	8.65252	31.2184	145
cluster_4.pdb ( medoid)	12.8715	9.08985	43.0975	117
cluster_5.pdb ( medoid)	12.5682	10.0253	20.8333	126
cluster_6.pdb ( medoid)	11.4646	6.97803	19.4708	80
cluster_7.pdb ( medoid)	8.55321	10.2885	28.0936	88
cluster_8.pdb ( medoid)	5.18995	9.82668	20.2546	51
cluster_9.pdb ( medoid)	4.21373	9.01814	35.7593	38
cluster_10.pdb ( medoid)	2.3974	11.2622	26.0255	27