Project name: b17f898304070df

Status: done

submitted: 2025-06-23 10:54:52, status changed: 2025-06-23 12:25:10

Project settings
Protein sequence(s) SCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFC input pdb
Peptide sequence RRKKAAVALLPAVLLALLAP
Simulation mc cycles50
Peptide secondary structure psipred CCHHHHHHHHHHHHHHHHCC
Unlikely to bind regions
107:A - 99:A 117:A - 168:A
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.3116 8.68902 29.4627 246
cluster_2.pdb ( medoid) 26.0414 3.14883 16.5687 82
cluster_3.pdb ( medoid) 16.7581 8.65252 31.2184 145
cluster_4.pdb ( medoid) 12.8715 9.08985 43.0975 117
cluster_5.pdb ( medoid) 12.5682 10.0253 20.8333 126
cluster_6.pdb ( medoid) 11.4646 6.97803 19.4708 80
cluster_7.pdb ( medoid) 8.55321 10.2885 28.0936 88
cluster_8.pdb ( medoid) 5.18995 9.82668 20.2546 51
cluster_9.pdb ( medoid) 4.21373 9.01814 35.7593 38
cluster_10.pdb ( medoid) 2.3974 11.2622 26.0255 27