CABS-dock: EVTVTEDKI

Project name: EVTVTEDKI_ıl12

Status: done

submitted: 2025-03-09 19:14:58, status changed: 2025-03-09 20:13:36

Project settings

Protein sequence(s)	SLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQ input pdb
Peptide sequence	EVTVTEDKI
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.8621	4.60692	16.9442	156
cluster_2.pdb ( medoid)	22.2388	4.94632	20.6437	110
cluster_3.pdb ( medoid)	21.7733	4.7765	25.3141	104
cluster_4.pdb ( medoid)	20.6132	6.11259	30.4558	126
cluster_5.pdb ( medoid)	16.0995	4.41008	9.38053	71
cluster_6.pdb ( medoid)	15.7855	3.80096	20.2916	60
cluster_7.pdb ( medoid)	15.7822	5.95606	22.3139	94
cluster_8.pdb ( medoid)	12.8912	10.4723	40.1015	135
cluster_9.pdb ( medoid)	5.92128	14.5239	32.771	86
cluster_10.pdb ( medoid)	5.52823	10.4916	29.8526	58