CABS-dock: b31b453191ab091

Project name: b31b453191ab091

Status: done

submitted: 2026-06-17 06:19:10, status changed: 2026-06-17 16:33:33

Project settings

Protein sequence(s)	ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGY input pdb
Peptide sequence	VELPTETQVE
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	32.3366	3.80374	16.1915	123
cluster_2.pdb ( medoid)	21.626	5.08646	30.4833	110
cluster_3.pdb ( medoid)	18.6392	8.15485	33.8813	152
cluster_4.pdb ( medoid)	14.404	9.0253	29.2129	130
cluster_5.pdb ( medoid)	12.8921	10.8594	36.5083	140
cluster_6.pdb ( medoid)	9.95011	5.72858	18.607	57
cluster_7.pdb ( medoid)	7.65744	8.2273	27.0439	63
cluster_8.pdb ( medoid)	4.68705	8.96086	36.1695	42
cluster_9.pdb ( medoid)	4.45579	12.1191	44.8593	54
cluster_10.pdb ( medoid)	1.93046	15.0223	28.5936	29