CABS-dock: TVTEDKINA

Project name: TVTEDKINA_ıl12

Status: done

submitted: 2025-03-09 19:16:00, status changed: 2025-03-09 20:14:26

Project settings

Protein sequence(s)	SLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQ input pdb
Peptide sequence	TVTEDKINA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCHHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.711	4.65519	14.3565	129
cluster_2.pdb ( medoid)	21.4955	5.81517	16.3467	125
cluster_3.pdb ( medoid)	19.1839	5.42122	19.5724	104
cluster_4.pdb ( medoid)	17.1555	5.82902	14.9811	100
cluster_5.pdb ( medoid)	15.8967	5.97608	14.2681	95
cluster_6.pdb ( medoid)	14.8731	6.32015	16.6303	94
cluster_7.pdb ( medoid)	13.2406	6.04204	16.273	80
cluster_8.pdb ( medoid)	12.9865	7.16128	22.1711	93
cluster_9.pdb ( medoid)	8.5389	10.4229	26.6855	89
cluster_10.pdb ( medoid)	7.55158	12.0505	26.5469	91