CABS-dock: b413617dc5e45bd

Project name: b413617dc5e45bd

Status: done

submitted: 2026-06-28 10:47:03, status changed: 2026-06-28 13:48:51

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	HHHVQPYGHHHHHHHHH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.0526	7.45307	30.8489	142
cluster_2.pdb ( medoid)	18.9719	5.74533	30.0747	109
cluster_3.pdb ( medoid)	15.8804	8.06024	31.1584	128
cluster_4.pdb ( medoid)	13.3173	12.1646	31.3231	162
cluster_5.pdb ( medoid)	12.6121	11.259	29.6329	142
cluster_6.pdb ( medoid)	8.50269	10.5849	32.8237	90
cluster_7.pdb ( medoid)	7.50575	11.3247	27.0943	85
cluster_8.pdb ( medoid)	4.01709	14.9362	35.0494	60
cluster_9.pdb ( medoid)	3.32164	16.5581	32.506	55
cluster_10.pdb ( medoid)	2.03239	13.2849	24.1858	27