Project name: 2evq

Status: done

submitted: 2025-12-12 15:55:55, status changed: 2025-12-12 19:09:36

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence KTWNPATGKWTE
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.6183 4.21956 22.3133 87
cluster_2.pdb ( medoid) 18.9533 10.1829 26.741 193
cluster_3.pdb ( medoid) 17.4556 4.81222 21.2782 84
cluster_4.pdb ( medoid) 15.7228 7.75945 27.6718 122
cluster_5.pdb ( medoid) 12.1556 7.65082 37.2401 93
cluster_6.pdb ( medoid) 11.2813 9.21879 34.4854 104
cluster_7.pdb ( medoid) 9.10789 9.22277 27.5342 84
cluster_8.pdb ( medoid) 7.15186 14.4019 47.6522 103
cluster_9.pdb ( medoid) 5.20459 13.4497 29.8564 70
cluster_10.pdb ( medoid) 4.56436 13.1453 32.4845 60