Project name: b5b8fcf6950adbe

Status: done

submitted: 2026-03-08 17:12:57, status changed: 2026-03-08 21:46:01

Project settings
Protein sequence(s) KNLVYALLGINVAVFGLWQLPKCWRFLQKYMLLQKDYVTSKISIIGSAFSHQEFWHLGMNMLALWSFGTSLATMLGASNFFSLYMNSAIAGSLFSLWYPKLARLAIVGPSLGASGALFGVLGCFSYLFPHAKILLFVFPVPGGAWVAFLASVAWNAAGCALRWGSFDYAAHLGGSMMGVLYGWYISKAVEKQRQRRLQAAGRWF input pdb
Peptide sequence TVPTATLIAA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 58.3387 2.07409 9.24895 121
cluster_2.pdb ( medoid) 31.0993 3.89077 9.66842 121
cluster_3.pdb ( medoid) 26.9563 4.11778 12.4287 111
cluster_4.pdb ( medoid) 26.35 4.70588 13.0169 124
cluster_5.pdb ( medoid) 24.3823 4.47046 27.4691 109
cluster_6.pdb ( medoid) 22.0988 5.15865 28.2611 114
cluster_7.pdb ( medoid) 18.101 6.51896 26.6683 118
cluster_8.pdb ( medoid) 13.6657 5.26866 12.002 72
cluster_9.pdb ( medoid) 9.49608 4.31757 7.8698 41
cluster_10.pdb ( medoid) 9.45697 7.29621 26.3991 69