CABS-dock: DGR

Project name: DGR

Status: done

submitted: 2026-04-18 14:29:59, status changed: 2026-04-18 18:42:05

Project settings

Protein sequence(s)	AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNANPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPESRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTE input pdb
Peptide sequence	CDGRPDRAC
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.9233	11.6315	38.7599	255
cluster_2.pdb ( medoid)	21.547	5.38357	42.2592	116
cluster_3.pdb ( medoid)	11.0988	7.92875	24.6224	88
cluster_4.pdb ( medoid)	10.897	9.81924	37.8274	107
cluster_5.pdb ( medoid)	10.5035	12.2816	34.7938	129
cluster_6.pdb ( medoid)	10.431	9.1075	25.4185	95
cluster_7.pdb ( medoid)	9.07831	6.49901	22.3379	59
cluster_8.pdb ( medoid)	4.25486	12.6914	33.0978	54
cluster_9.pdb ( medoid)	3.11546	17.6539	40.8261	55
cluster_10.pdb ( medoid)	2.69619	15.5776	32.8051	42