CABS-dock: b6de1e03b35cdbd

Project name: b6de1e03b35cdbd

Status: done

submitted: 2026-03-12 14:36:28, status changed: 2026-03-12 22:10:27

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RRMKWKKVQLFGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.5543	5.64359	32.6597	116
cluster_2.pdb ( medoid)	16.462	5.40639	27.4801	89
cluster_3.pdb ( medoid)	14.3764	9.59907	42.4882	138
cluster_4.pdb ( medoid)	9.26969	10.7878	35.5431	100
cluster_5.pdb ( medoid)	8.77537	11.7374	38.31	103
cluster_6.pdb ( medoid)	6.44251	16.6084	61.5672	107
cluster_7.pdb ( medoid)	6.42321	21.4846	49.8443	138
cluster_8.pdb ( medoid)	5.57807	12.1906	27.9623	68
cluster_9.pdb ( medoid)	4.52258	17.0257	45.2674	77
cluster_10.pdb ( medoid)	3.85579	16.5984	37.8117	64