Project name: b6de1e03b35cdbd

Status: done

submitted: 2026-03-12 14:36:28, status changed: 2026-03-12 22:10:27

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence RRMKWKKVQLFGSNDA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCEEEECCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.5543 5.64359 32.6597 116
cluster_2.pdb ( medoid) 16.462 5.40639 27.4801 89
cluster_3.pdb ( medoid) 14.3764 9.59907 42.4882 138
cluster_4.pdb ( medoid) 9.26969 10.7878 35.5431 100
cluster_5.pdb ( medoid) 8.77537 11.7374 38.31 103
cluster_6.pdb ( medoid) 6.44251 16.6084 61.5672 107
cluster_7.pdb ( medoid) 6.42321 21.4846 49.8443 138
cluster_8.pdb ( medoid) 5.57807 12.1906 27.9623 68
cluster_9.pdb ( medoid) 4.52258 17.0257 45.2674 77
cluster_10.pdb ( medoid) 3.85579 16.5984 37.8117 64