CABS-dock: b7bdfe8a96bdf7f

Project name: b7bdfe8a96bdf7f

Status: done

submitted: 2025-12-31 16:01:49, status changed: 2025-12-31 21:48:32

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RVIVQVGSNCFR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.0991	5.76785	23.5978	139
cluster_2.pdb ( medoid)	20.9699	5.15024	18.3584	108
cluster_3.pdb ( medoid)	20.6134	6.01549	35.6857	124
cluster_4.pdb ( medoid)	17.8523	6.60978	31.1086	118
cluster_5.pdb ( medoid)	16.4143	8.22452	28.2179	135
cluster_6.pdb ( medoid)	13.9772	14.5952	38.1783	204
cluster_7.pdb ( medoid)	4.01074	10.4719	29.2907	42
cluster_8.pdb ( medoid)	3.54905	14.6518	31.7227	52
cluster_9.pdb ( medoid)	3.19689	17.517	32.4645	56
cluster_10.pdb ( medoid)	1.33412	16.4902	28.4055	22