CABS-dock: b7e571bf82a1732

Project name: b7e571bf82a1732

Status: done

submitted: 2026-03-23 02:01:30, status changed: 2026-03-23 06:43:28

Project settings

Protein sequence(s)	MKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKK input pdb
Peptide sequence	RHWARNP
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	77.8295	1.38765	7.32466	108
cluster_2.pdb ( medoid)	61.4516	2.06667	10.1001	127
cluster_3.pdb ( medoid)	31.1149	4.17807	10.3244	130
cluster_4.pdb ( medoid)	28.998	3.96579	16.9949	115
cluster_5.pdb ( medoid)	27.0445	3.32784	9.6496	90
cluster_6.pdb ( medoid)	26.6246	5.18318	23.0894	138
cluster_7.pdb ( medoid)	19.2609	5.13994	14.7825	99
cluster_8.pdb ( medoid)	14.6231	4.78693	12.3948	70
cluster_9.pdb ( medoid)	14.3102	5.59043	11.6609	80
cluster_10.pdb ( medoid)	10.6487	4.03805	11.0281	43