Project name: b866b578bed798d

Status: done

submitted: 2026-02-27 13:12:06, status changed: 2026-02-27 20:01:54

Project settings
Protein sequence(s) MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL input pdb
Peptide sequence FESLQPSDTDLGAKVPK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 36.5406 3.36611 22.2902 123
cluster_2.pdb ( medoid) 23.4856 5.91853 27.7631 139
cluster_3.pdb ( medoid) 17.2763 7.7563 37.2301 134
cluster_4.pdb ( medoid) 15.799 6.4561 19.6847 102
cluster_5.pdb ( medoid) 12.9161 12.0779 33.1546 156
cluster_6.pdb ( medoid) 11.1393 10.9522 25.5407 122
cluster_7.pdb ( medoid) 6.47641 9.10999 36.8959 59
cluster_8.pdb ( medoid) 5.75864 13.8922 33.262 80
cluster_9.pdb ( medoid) 5.67768 9.86317 23.7114 56
cluster_10.pdb ( medoid) 2.55729 11.3401 24.7511 29