Project name: b8751265e39a941

Status: done

submitted: 2026-02-18 08:05:55, status changed: 2026-02-18 22:44:12

Project settings
Protein sequence(s) DIEADHVGTYGISVYQSPGDIGQYTFEFDGDELFYVDLDKKETVWMLPEFGQLASFDPQGGLQNIAVVKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWSSADLPVSKMRMATPLLMQASERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWSSAE input pdb
Peptide sequence DTGSTGVGTAAGVTPSAT
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 38.6706 2.66352 26.4596 103
cluster_2.pdb ( medoid) 33.8206 3.28202 18.1697 111
cluster_3.pdb ( medoid) 26.1303 3.98006 38.0965 104
cluster_4.pdb ( medoid) 15.546 8.87685 46.4492 138
cluster_5.pdb ( medoid) 12.2292 9.89436 54.2671 121
cluster_6.pdb ( medoid) 11.5996 6.03469 11.0623 70
cluster_7.pdb ( medoid) 8.47298 10.2679 25.4282 87
cluster_8.pdb ( medoid) 4.45575 16.1589 39.133 72
cluster_9.pdb ( medoid) 3.2289 18.2725 39.0082 59
cluster_10.pdb ( medoid) 2.59124 20.0676 44.3683 52