Project name: b8c4bc39e798a4f

Status: done

submitted: 2026-04-02 12:36:19, status changed: 2026-04-02 14:53:37

Project settings
Protein sequence(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb
Peptide sequence LKEFLKRWARLLRW
Simulation mc cycles50
Peptide secondary structure psipred CHHHHHHHHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 64.9028 1.58699 19.7858 103
cluster_2.pdb ( medoid) 29.9086 2.64138 17.0808 79
cluster_3.pdb ( medoid) 26.2093 5.60869 21.7856 147
cluster_4.pdb ( medoid) 24.885 5.54551 15.6397 138
cluster_5.pdb ( medoid) 21.311 4.83319 18.6465 103
cluster_6.pdb ( medoid) 15.4333 8.29374 32.2666 128
cluster_7.pdb ( medoid) 4.35281 12.6355 25.1571 55
cluster_8.pdb ( medoid) 4.29427 14.205 26.013 61
cluster_9.pdb ( medoid) 4.25107 11.5265 22.7753 49
cluster_10.pdb ( medoid) 3.10042 11.9339 22.8816 37