Project name: b8d515412140a05

Status: done

submitted: 2026-03-12 14:57:38, status changed: 2026-03-12 18:32:19

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence WRVQLFGSNDA
Simulation mc cycles50
Peptide secondary structure psipred CCEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.8893 3.59035 24.5421 75
cluster_2.pdb ( medoid) 17.2558 10.3733 38.3984 179
cluster_3.pdb ( medoid) 11.6377 10.3113 24.6009 120
cluster_4.pdb ( medoid) 11.0647 9.3089 27.5611 103
cluster_5.pdb ( medoid) 8.71966 12.7299 29.8255 111
cluster_6.pdb ( medoid) 7.88646 11.1584 28.3361 88
cluster_7.pdb ( medoid) 7.85896 12.9788 31.9859 102
cluster_8.pdb ( medoid) 7.25625 11.1628 27.0214 81
cluster_9.pdb ( medoid) 6.93412 10.095 34.1197 70
cluster_10.pdb ( medoid) 4.39299 16.1621 41.8514 71