Project name: FOLD_236-TRAIL

Status: done

submitted: 2025-12-26 17:41:39, status changed: 2025-12-26 22:14:11

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence MKSARNSCWSKDAE
Simulation mc cycles100
Peptide secondary structure psipred CCCCCHHCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.4712 6.1285 20.5979 199
cluster_2.pdb ( medoid) 20.5909 8.01324 29.4677 165
cluster_3.pdb ( medoid) 15.7984 7.08931 25.0944 112
cluster_4.pdb ( medoid) 10.3531 7.24417 20.6515 75
cluster_5.pdb ( medoid) 10.3098 9.21457 19.8785 95
cluster_6.pdb ( medoid) 9.12693 6.68352 14.006 61
cluster_7.pdb ( medoid) 7.92199 12.2444 25.8222 97
cluster_8.pdb ( medoid) 7.54569 10.337 21.512 78
cluster_9.pdb ( medoid) 5.99938 7.83415 25.1533 47
cluster_10.pdb ( medoid) 4.23033 16.7836 34.6376 71