Project name: 5hto&Pep4

Status: done

submitted: 2025-02-04 08:32:28, status changed: 2025-02-04 17:29:31

Project settings
Protein sequence(s) KPKIVLVGSGMIGGVMATLIVQKNLGDVVMFDVVKNMPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPLLPLNNKIMIEIGGHIKNLCPNAFIIVVTNPVDVMVQLLFEHSGVPKNKIIGLGGVLDTSRLKYYISQKLNNVCPRDVNALIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDEEVEGIFDRTVNTALEIVNLLASPYVAPAAAIIEMAESYLKDIKKVLVCSTLLEGQYGHSNIFGGTPLVIGGTGVEQVIELQLNAEEKTKFDEAVAETKRMKALI input pdb
Peptide sequence NVIGTLSLIIGGTGE
Simulation mc cycles50
Peptide secondary structure psipred CCCEEEEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 47.7353 5.15342 19.9516 246
cluster_2.pdb ( medoid) 25.8329 2.55488 5.42523 66
cluster_3.pdb ( medoid) 16.0495 6.47994 27.226 104
cluster_4.pdb ( medoid) 15.6155 8.58124 24.7052 134
cluster_5.pdb ( medoid) 14.2446 7.93282 33.4677 113
cluster_6.pdb ( medoid) 11.778 10.613 27.8199 125
cluster_7.pdb ( medoid) 8.72503 5.3868 11.4381 47
cluster_8.pdb ( medoid) 8.29792 8.19483 20.2986 68
cluster_9.pdb ( medoid) 5.26284 13.3008 25.1134 70
cluster_10.pdb ( medoid) 2.07369 13.0202 26.331 27