CABS-dock: CRVTARR04a

Project name: CRVTARR04a

Status: done

submitted: 2026-07-15 03:37:52, status changed: 2026-07-15 05:19:26

Project settings

Protein sequence(s)	AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA input pdb
Peptide sequence	CRVTARR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	53.7493	5.93496	38.9142	319
cluster_2.pdb ( medoid)	31.3072	2.04426	9.95067	64
cluster_3.pdb ( medoid)	28.1907	6.31413	14.9912	178
cluster_4.pdb ( medoid)	25.1917	3.05656	10.3174	77
cluster_5.pdb ( medoid)	14.3682	7.65577	35.9767	110
cluster_6.pdb ( medoid)	9.86394	4.25793	11.5281	42
cluster_7.pdb ( medoid)	6.55403	9.91755	29.2146	65
cluster_8.pdb ( medoid)	6.01548	7.31446	24.3545	44
cluster_9.pdb ( medoid)	4.15252	15.894	44.6098	66
cluster_10.pdb ( medoid)	2.05804	17.0065	35.8452	35