Project name: ba37a086a85dac3

Status: done

submitted: 2026-06-23 19:39:54, status changed: 2026-06-23 22:08:07

Project settings
Protein sequence(s) AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV input pdb
Peptide sequence DWVGW
Simulation mc cycles50
Peptide secondary structure psipred CCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 72.7761 1.77256 6.09504 129
cluster_2.pdb ( medoid) 49.5467 2.36141 16.0698 117
cluster_3.pdb ( medoid) 33.88 3.83707 26.1545 130
cluster_4.pdb ( medoid) 31.3503 5.03983 33.9844 158
cluster_5.pdb ( medoid) 27.1609 3.64495 26.7769 99
cluster_6.pdb ( medoid) 16.0588 4.7326 23.533 76
cluster_7.pdb ( medoid) 13.9698 3.86549 21.0101 54
cluster_8.pdb ( medoid) 9.95444 8.03661 31.8747 80
cluster_9.pdb ( medoid) 4.68949 19.6183 40.6601 92
cluster_10.pdb ( medoid) 3.42688 18.9677 47.834 65