CABS-dock: ba37a086a85dac3

Project name: ba37a086a85dac3

Status: done

submitted: 2026-06-23 19:39:54, status changed: 2026-06-23 22:08:07

Project settings

Protein sequence(s)	AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV input pdb
Peptide sequence	DWVGW
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	72.7761	1.77256	6.09504	129
cluster_2.pdb ( medoid)	49.5467	2.36141	16.0698	117
cluster_3.pdb ( medoid)	33.88	3.83707	26.1545	130
cluster_4.pdb ( medoid)	31.3503	5.03983	33.9844	158
cluster_5.pdb ( medoid)	27.1609	3.64495	26.7769	99
cluster_6.pdb ( medoid)	16.0588	4.7326	23.533	76
cluster_7.pdb ( medoid)	13.9698	3.86549	21.0101	54
cluster_8.pdb ( medoid)	9.95444	8.03661	31.8747	80
cluster_9.pdb ( medoid)	4.68949	19.6183	40.6601	92
cluster_10.pdb ( medoid)	3.42688	18.9677	47.834	65