Project name: Docking project

Status: done

submitted: 2026-07-10 17:19:30, status changed: 2026-07-10 20:39:47

Project settings
Protein sequence(s) AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNASATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGDTFTKV input pdb
Peptide sequence AGDWVGWCGGSGAET
Simulation mc cycles100
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.2725 6.31993 28.4207 185
cluster_2.pdb ( medoid) 18.552 6.73782 31.8804 125
cluster_3.pdb ( medoid) 18.3208 8.02365 40.3246 147
cluster_4.pdb ( medoid) 12.0624 6.4664 24.4319 78
cluster_5.pdb ( medoid) 11.7018 7.34929 25.9143 86
cluster_6.pdb ( medoid) 11.2679 7.54353 25.6941 85
cluster_7.pdb ( medoid) 6.83425 17.266 46.8826 118
cluster_8.pdb ( medoid) 5.83025 12.0063 32.7352 70
cluster_9.pdb ( medoid) 3.57995 18.1567 38.9722 65
cluster_10.pdb ( medoid) 2.59401 15.8057 32.1001 41