Project name: 3IEC_Third_sEQUENCE

Status: done

submitted: 2026-04-19 12:56:46, status changed: 2026-04-19 14:07:32

Project settings
Protein sequence(s) HIGNYRLLKTIGAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGWMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGY input pdb
Peptide sequence GLLKKIKWLL
Simulation mc cycles5
Peptide secondary structure psipred CHHHHHHHHC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 61.4374 1.62767 3.87872 100
cluster_2.pdb ( medoid) 54.4924 0.972613 2.2355 53
cluster_3.pdb ( medoid) 20.4189 1.37128 5.99323 28
cluster_4.pdb ( medoid) 20.1833 5.00414 22.9241 101
cluster_5.pdb ( medoid) 19.963 8.31538 30.9856 166
cluster_6.pdb ( medoid) 18.3441 6.75968 16.8779 124
cluster_7.pdb ( medoid) 18.0702 1.05146 1.67076 19
cluster_8.pdb ( medoid) 15.4413 8.67804 32.18 134
cluster_9.pdb ( medoid) 13.4351 5.80571 25.6898 78
cluster_10.pdb ( medoid) 8.41263 11.768 32.5771 99