CABS-dock: bb681fa6a11eb0c

Project name: bb681fa6a11eb0c

Status: done

submitted: 2026-04-09 10:47:38, status changed: 2026-04-09 12:53:29

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRRVQLFPGSNDARRRH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.8628	8.45801	32.0533	168
cluster_2.pdb ( medoid)	18.0897	8.01561	26.6873	145
cluster_3.pdb ( medoid)	14.3122	6.42807	21.049	92
cluster_4.pdb ( medoid)	11.5829	4.40305	26.4001	51
cluster_5.pdb ( medoid)	11.3407	11.1986	29.2142	127
cluster_6.pdb ( medoid)	6.95534	16.9654	37.2052	118
cluster_7.pdb ( medoid)	6.63026	11.7643	24.4039	78
cluster_8.pdb ( medoid)	5.82839	14.0691	30.41	82
cluster_9.pdb ( medoid)	5.50496	18.3471	42.7944	101
cluster_10.pdb ( medoid)	2.87075	13.2369	24.0721	38