CABS-dock: bc5a85fe5255b5f

Project name: bc5a85fe5255b5f

Status: done

submitted: 2025-12-29 08:47:59, status changed: 2025-12-29 09:37:54

Project settings

Protein sequence(s)	AVCGPACGFVGAHYVPIAWAGVTAATGGFGKIRK input pdb
Peptide sequence	RGKYALADA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.3005	9.41683	34.3627	210
cluster_2.pdb ( medoid)	18.5527	6.62975	19.8416	123
cluster_3.pdb ( medoid)	17.5254	6.39074	15.4547	112
cluster_4.pdb ( medoid)	17.4902	4.68834	13.5711	82
cluster_5.pdb ( medoid)	16.4482	7.11326	17.1507	117
cluster_6.pdb ( medoid)	13.6103	4.62884	14.143	63
cluster_7.pdb ( medoid)	10.1216	10.8679	37.9514	110
cluster_8.pdb ( medoid)	7.41259	11.1972	26.4929	83
cluster_9.pdb ( medoid)	5.24829	11.6228	30.2059	61
cluster_10.pdb ( medoid)	3.19132	12.2206	26.3827	39