Project name: JSLEE_27

Status: done

submitted: 2023-11-29 04:35:34, status changed: 2023-11-29 06:57:12

Project settings
Protein sequence(s) SRRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLNPEGG input pdb
Peptide sequence ENNVLSPLPSQAMDDLMLSPDDIEQWFTED
Simulation mc cycles50
Peptide secondary structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Flexible regions
100:A - 92:A
Unlikely to bind regions
158:A - 181:A
Contact information
146:A 19:PEP 10.0 1.0
126:A 26:PEP 5.0 1.0
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.5537 4.76137 16.0073 155
cluster_2.pdb ( medoid) 17.4969 10.2304 28.7463 179
cluster_3.pdb ( medoid) 15.5667 10.985 33.2911 171
cluster_4.pdb ( medoid) 13.9959 8.64537 24.3632 121
cluster_5.pdb ( medoid) 11.5251 5.72666 24.7317 66
cluster_6.pdb ( medoid) 11.4526 5.06436 11.9307 58
cluster_7.pdb ( medoid) 8.50023 9.52915 17.4052 81
cluster_8.pdb ( medoid) 8.0912 9.88728 22.4407 80
cluster_9.pdb ( medoid) 3.44333 17.1346 30.6982 59
cluster_10.pdb ( medoid) 2.27014 13.2151 26.5103 30