CABS-dock: 8TBP_HKSAIV

Project name: 8TBP_HKSAIV_E2

Status: done

submitted: 2026-05-30 16:20:35, status changed: 2026-05-31 02:59:16

Project settings

Protein sequence(s)	DTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA input pdb
Peptide sequence	HKSAIVTLTYDSEWQRDQ
Simulation mc cycles	200
Peptide secondary structure psipred	CCCEEEEEECCCCHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	14.2464	8.70396	47.5658	124
cluster_2.pdb ( medoid)	14.2293	10.12	42.1559	144
cluster_3.pdb ( medoid)	12.9668	14.73	63.7535	191
cluster_4.pdb ( medoid)	12.5531	8.20516	25.2151	103
cluster_5.pdb ( medoid)	11.5353	8.32225	37.3118	96
cluster_6.pdb ( medoid)	10.589	7.74389	39.5369	82
cluster_7.pdb ( medoid)	7.77679	7.07232	25.0871	55
cluster_8.pdb ( medoid)	4.30874	14.6215	30.591	63
cluster_9.pdb ( medoid)	3.11812	17.9595	40.1259	56
cluster_10.pdb ( medoid)	1.93021	22.2774	48.0512	43