Project name: be3476d267aefcd

Status: done

submitted: 2026-01-10 15:03:27, status changed: 2026-01-10 18:04:03

Project settings
Protein sequence(s) MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence LPPTDESIKYTIYNSTGIQIGAYNYMEIGG
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCEEEECCCCEEECCCCEECCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.748 4.74767 21.3463 108
cluster_2.pdb ( medoid) 15.8637 8.06871 24.8546 128
cluster_3.pdb ( medoid) 12.071 6.21326 23.6641 75
cluster_4.pdb ( medoid) 11.2829 11.5219 27.6004 130
cluster_5.pdb ( medoid) 10.634 15.3282 29.0474 163
cluster_6.pdb ( medoid) 6.80263 13.6712 31.2569 93
cluster_7.pdb ( medoid) 6.42832 15.7117 31.0299 101
cluster_8.pdb ( medoid) 6.3761 14.4289 30.357 92
cluster_9.pdb ( medoid) 6.19158 7.91398 20.1413 49
cluster_10.pdb ( medoid) 4.62879 13.1784 27.5636 61