CABS-dock: RBX1

Project name: RBX1_binder6

Status: done

submitted: 2026-03-22 02:06:22, status changed: 2026-03-22 04:34:41

Project settings

Protein sequence(s)	MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH input pdb
Peptide sequence	RYTDDGETLMEEALRQQELEQRDTICYRNT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCHHHHHHHHHHHHHHHHHHHCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.4126	4.01493	14.9961	94
cluster_2.pdb ( medoid)	18.0313	6.15596	30.591	111
cluster_3.pdb ( medoid)	16.5759	7.17909	19.7765	119
cluster_4.pdb ( medoid)	15.8546	8.01031	38.6124	127
cluster_5.pdb ( medoid)	14.0765	6.89091	20.5958	97
cluster_6.pdb ( medoid)	9.17908	9.47807	23.006	87
cluster_7.pdb ( medoid)	8.23115	10.3266	27.5498	85
cluster_8.pdb ( medoid)	8.20173	3.41391	10.4246	28
cluster_9.pdb ( medoid)	6.9899	11.159	26.2184	78
cluster_10.pdb ( medoid)	5.93276	12.4731	23.1427	74