Project name: RBX1_binder6

Status: done

submitted: 2026-03-22 02:06:22, status changed: 2026-03-22 04:34:41

Project settings
Protein sequence(s) MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH input pdb
Peptide sequence RYTDDGETLMEEALRQQELEQRDTICYRNT
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHHHHHHHHHHHHHHHHHCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.4126 4.01493 14.9961 94
cluster_2.pdb ( medoid) 18.0313 6.15596 30.591 111
cluster_3.pdb ( medoid) 16.5759 7.17909 19.7765 119
cluster_4.pdb ( medoid) 15.8546 8.01031 38.6124 127
cluster_5.pdb ( medoid) 14.0765 6.89091 20.5958 97
cluster_6.pdb ( medoid) 9.17908 9.47807 23.006 87
cluster_7.pdb ( medoid) 8.23115 10.3266 27.5498 85
cluster_8.pdb ( medoid) 8.20173 3.41391 10.4246 28
cluster_9.pdb ( medoid) 6.9899 11.159 26.2184 78
cluster_10.pdb ( medoid) 5.93276 12.4731 23.1427 74