CABS-dock: RO33.3

Project name: RO33.3_USP7

Status: done

submitted: 2026-01-12 05:27:56, status changed: 2026-01-12 09:21:49

Project settings

Protein sequence(s)	TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWGARAHSS input pdb
Peptide sequence	ATVPSGTASTKGAIRSPGAANPSDDSS
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.4046	6.02555	20.9741	135
cluster_2.pdb ( medoid)	16.1592	7.73554	35.071	125
cluster_3.pdb ( medoid)	15.8926	9.37541	30.1933	149
cluster_4.pdb ( medoid)	13.888	10.2967	18.9676	143
cluster_5.pdb ( medoid)	12.6424	14.396	35.4672	182
cluster_6.pdb ( medoid)	7.59452	13.2991	27.4555	101
cluster_7.pdb ( medoid)	5.86733	6.3061	20.5928	37
cluster_8.pdb ( medoid)	5.53617	9.93467	24.0901	55
cluster_9.pdb ( medoid)	3.79646	11.5898	24.8135	44
cluster_10.pdb ( medoid)	3.07125	9.44242	35.8265	29