CABS-dock: be6c60ce01e5957

Project name: be6c60ce01e5957

Status: done

submitted: 2025-08-25 07:32:06, status changed: 2025-08-25 12:10:34

Project settings

Protein sequence(s)	AVQLQESGGGLVQAGGSLRLSCTASGRISSSYDMGWFRQAPGKEREFVAAISWSGGTTDYADSVKGRFAISKDNAKNAVYLQMNSLKPEDTAVYYCAAKWRPLRYSDYPSNSDYYDWGQGTQVTVSSAVQLQESGGGLVQAGGSLRLSCTASGRISSSYDMGWFRQAPGKEREFVAAISWSGGTTDYADSVKGRFAISKDNAKNAVYLQMNSLKPEDTAVYYCAAKWRPLRYSDYPSNSDYYDWGQGTQVTVSS input pdb
Peptide sequence	QRTVAVYSLRIAGFHG
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEEEEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	32.0807	3.42885	30.1101	110
cluster_2.pdb ( medoid)	28.2355	4.07289	20.8103	115
cluster_3.pdb ( medoid)	15.1298	12.4258	33.5279	188
cluster_4.pdb ( medoid)	12.4594	9.63126	26.6567	120
cluster_5.pdb ( medoid)	11.0761	12.4592	26.3207	138
cluster_6.pdb ( medoid)	8.41881	6.88933	13.9365	58
cluster_7.pdb ( medoid)	7.34851	11.1587	25.5196	82
cluster_8.pdb ( medoid)	6.7855	11.4951	29.2591	78
cluster_9.pdb ( medoid)	5.61164	7.30624	21.9848	41
cluster_10.pdb ( medoid)	5.0475	13.8682	32.7897	70