CABS-dock: LepB_3Y

Project name: LepB_3Y_3

Status: done

submitted: 2026-06-03 03:08:30, status changed: 2026-06-03 09:58:03

Project settings

Protein sequence(s)	RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDGLRLSRIGGIH input pdb
Peptide sequence	MLSFAADYYYEGDD
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	31.8372	5.02557	22.4403	160
cluster_2.pdb ( medoid)	19.6039	6.01922	37.3197	118
cluster_3.pdb ( medoid)	14.4542	7.12595	15.5455	103
cluster_4.pdb ( medoid)	13.3932	10.0797	37.1651	135
cluster_5.pdb ( medoid)	13.0767	8.79428	41.1278	115
cluster_6.pdb ( medoid)	8.17897	11.0038	41.8566	90
cluster_7.pdb ( medoid)	6.46639	11.4438	34.0811	74
cluster_8.pdb ( medoid)	4.86012	11.7281	36.5449	57
cluster_9.pdb ( medoid)	4.84695	13.2042	38.1438	64
cluster_10.pdb ( medoid)	4.27713	19.6393	43.897	84