Project name: c05a6fbe73f5092

Status: done

submitted: 2026-01-21 23:15:59, status changed: 2026-01-22 01:42:53

Project settings
Protein sequence(s) RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP input pdb
Peptide sequence SHMAELKELNDKRLAAQRAS
Simulation mc cycles50
Peptide secondary structure psipred CCHHHHHHHHHHHHHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.8605 7.08646 26.2792 162
cluster_2.pdb ( medoid) 22.7724 4.47911 19.6501 102
cluster_3.pdb ( medoid) 22.5754 7.61891 24.4853 172
cluster_4.pdb ( medoid) 15.3753 12.2274 33.2864 188
cluster_5.pdb ( medoid) 14.8877 5.91093 21.0324 88
cluster_6.pdb ( medoid) 10.0033 10.6964 25.018 107
cluster_7.pdb ( medoid) 6.80202 4.70448 13.0026 32
cluster_8.pdb ( medoid) 6.76005 5.17747 26.4997 35
cluster_9.pdb ( medoid) 6.66931 9.14637 19.9942 61
cluster_10.pdb ( medoid) 4.6327 11.4404 32.7312 53