CABS-dock: c05a6fbe73f5092

Project name: c05a6fbe73f5092

Status: done

submitted: 2026-01-21 23:15:59, status changed: 2026-01-22 01:42:53

Project settings

Protein sequence(s)	RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP input pdb
Peptide sequence	SHMAELKELNDKRLAAQRAS
Simulation mc cycles	50
Peptide secondary structure psipred	CCHHHHHHHHHHHHHHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.8605	7.08646	26.2792	162
cluster_2.pdb ( medoid)	22.7724	4.47911	19.6501	102
cluster_3.pdb ( medoid)	22.5754	7.61891	24.4853	172
cluster_4.pdb ( medoid)	15.3753	12.2274	33.2864	188
cluster_5.pdb ( medoid)	14.8877	5.91093	21.0324	88
cluster_6.pdb ( medoid)	10.0033	10.6964	25.018	107
cluster_7.pdb ( medoid)	6.80202	4.70448	13.0026	32
cluster_8.pdb ( medoid)	6.76005	5.17747	26.4997	35
cluster_9.pdb ( medoid)	6.66931	9.14637	19.9942	61
cluster_10.pdb ( medoid)	4.6327	11.4404	32.7312	53