Project name: c06f197123bd299

Status: done

submitted: 2026-01-21 14:59:53, status changed: 2026-01-21 17:26:13

Project settings
Protein sequence(s) GTVFTTVEDLLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSSDDQWGEYSCVFLPEPMGTANIQLHG input pdb
Peptide sequence VPSENDGTFTSNLTGHTKKT
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCEECCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 46.101 2.19084 20.4923 101
cluster_2.pdb ( medoid) 33.9348 5.92312 19.9969 201
cluster_3.pdb ( medoid) 27.5662 3.99039 26.2891 110
cluster_4.pdb ( medoid) 22.0575 6.93642 25.6889 153
cluster_5.pdb ( medoid) 12.3039 8.53389 17.6451 105
cluster_6.pdb ( medoid) 10.3152 10.9547 24.5577 113
cluster_7.pdb ( medoid) 9.71399 7.30904 17.141 71
cluster_8.pdb ( medoid) 6.7783 9.88448 23.5846 67
cluster_9.pdb ( medoid) 6.39706 7.97241 19.3263 51
cluster_10.pdb ( medoid) 2.59075 10.8077 25.4112 28