Project name: 2EXL-P08670-3

Status: done

submitted: 2025-02-05 01:14:28, status changed: 2025-02-05 13:30:10

Project settings
Protein sequence(s) KSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIASTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMNSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTISTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN input pdb
Peptide sequence SSPGGVYATRSSAVRLR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCEEECCCCCEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 46.9172 1.8117 3.76931 85
cluster_2.pdb ( medoid) 31.3703 3.88903 36.1492 122
cluster_3.pdb ( medoid) 14.7296 7.19641 48.473 106
cluster_4.pdb ( medoid) 13.8704 8.36312 42.1184 116
cluster_5.pdb ( medoid) 13.2899 11.2115 28.528 149
cluster_6.pdb ( medoid) 11.6022 12.9286 45.3013 150
cluster_7.pdb ( medoid) 10.0081 10.8912 43.6549 109
cluster_8.pdb ( medoid) 4.12663 1.93863 3.36643 8
cluster_9.pdb ( medoid) 2.11818 25.9657 51.4501 55
cluster_10.pdb ( medoid) 0.949342 27.3874 49.2736 26