CABS-dock: c178d79fde41bb7

Project name: c178d79fde41bb7

Status: done

submitted: 2026-01-12 14:59:11, status changed: 2026-01-12 18:16:33

Project settings

Protein sequence(s)	MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATDIHMEQSILRRVQLGHSNEMRLHGVMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence	RVIVQVGSNCFR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	50.804	2.3817	14.7123	121
cluster_2.pdb ( medoid)	21.256	8.42114	25.4132	179
cluster_3.pdb ( medoid)	17.0401	8.568	33.6531	146
cluster_4.pdb ( medoid)	13.4737	4.97266	17.2034	67
cluster_5.pdb ( medoid)	12.4248	7.24356	18.7559	90
cluster_6.pdb ( medoid)	12.3599	6.79617	20.3063	84
cluster_7.pdb ( medoid)	6.67316	16.9335	41.505	113
cluster_8.pdb ( medoid)	6.34502	9.61384	28.1197	61
cluster_9.pdb ( medoid)	6.34057	11.5132	29.3255	73
cluster_10.pdb ( medoid)	4.56405	14.4608	37.077	66