Project name: c19bbc171fdd2ab

Status: done

submitted: 2026-02-19 23:42:32, status changed: 2026-02-20 04:00:54

Project settings
Protein sequence(s) VLLLDVTPLSLGIETMMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQH input pdb
Peptide sequence SHPRPIRV
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 43.0596 2.81006 23.4138 121
cluster_2.pdb ( medoid) 32.422 2.74505 17.4675 89
cluster_3.pdb ( medoid) 22.1869 5.63396 26.9736 125
cluster_4.pdb ( medoid) 21.4711 3.67937 13.9685 79
cluster_5.pdb ( medoid) 16.8509 9.96979 31.2937 168
cluster_6.pdb ( medoid) 15.9219 4.14523 14.4356 66
cluster_7.pdb ( medoid) 14.8364 8.08822 30.485 120
cluster_8.pdb ( medoid) 10.8968 10.2782 20.874 112
cluster_9.pdb ( medoid) 8.21468 6.2084 15.0321 51
cluster_10.pdb ( medoid) 6.27279 10.9999 25.7174 69