Project name: JSLEE_25

Status: done

submitted: 2023-11-28 13:30:29, status changed: 2023-11-28 15:09:49

Project settings
Protein sequence(s) SRRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLNPEGG input pdb
Peptide sequence DLMLSPDDIEQWFTED
Simulation mc cycles50
Peptide secondary structure CCCCCCCCCCCCCCCC
Flexible regions
92:A - 99:A
Unlikely to bind regions
159:A - 181:A
Contact information
148:A 5:PEP 10.0 1.0
126:A 12:PEP 6.0 1.0
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 50.5865 2.74777 9.08726 139
cluster_2.pdb ( medoid) 34.2051 4.97001 12.4797 170
cluster_3.pdb ( medoid) 19.3515 5.42593 13.6681 105
cluster_4.pdb ( medoid) 19.0306 10.3517 23.3198 197
cluster_5.pdb ( medoid) 15.7117 5.21904 17.3428 82
cluster_6.pdb ( medoid) 12.8981 5.58222 13.7799 72
cluster_7.pdb ( medoid) 11.6956 6.15617 12.1546 72
cluster_8.pdb ( medoid) 9.414 5.62991 12.8643 53
cluster_9.pdb ( medoid) 8.25886 8.23358 16.8448 68
cluster_10.pdb ( medoid) 6.31807 6.6476 15.4621 42