CABS-dock: LHO_Neg_Mut 15

Project name: LHO_Neg_Mut 15_M1R

Status: running

submitted: 2025-11-26 06:18:26, status changed: 2025-11-26 06:27:22

Project settings

Protein sequence(s)

MGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTGVQFYMIVIGVIILAALFMYYAKRMLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPMIIATTDMQN input pdb

Peptide sequence

KRLVLPARAPLVALWAALKA

Simulation mc cycles

Peptide secondary structure psipred

CCCCCCCCHHHHHHHHHHHC

Unlikely to bind regions

186:A - 250:A

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue