CABS-dock: ALGLGILLV manvi

Project name: ALGLGILLV manvi

Status: done

submitted: 2025-07-02 06:28:38, status changed: 2025-07-02 17:52:33

Project settings

Protein sequence(s)	GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWMIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM input pdb
Peptide sequence	ALGLGILLV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	45.8236	2.42233	5.87872	111
cluster_2.pdb ( medoid)	36.7406	1.66029	3.4089	61
cluster_3.pdb ( medoid)	20.5156	10.3823	47.5841	213
cluster_4.pdb ( medoid)	19.521	6.60827	31.5483	129
cluster_5.pdb ( medoid)	19.414	2.72999	20.6936	53
cluster_6.pdb ( medoid)	15.4145	10.0555	42.702	155
cluster_7.pdb ( medoid)	10.3537	11.3003	38.9532	117
cluster_8.pdb ( medoid)	5.93857	10.777	31.1956	64
cluster_9.pdb ( medoid)	5.57458	7.71359	35.266	43
cluster_10.pdb ( medoid)	2.63715	20.4766	38.4192	54