CABS-dock: c31a61e04938dc8

Project name: c31a61e04938dc8

Status: done

submitted: 2025-12-31 06:25:08, status changed: 2025-12-31 08:24:43

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	RVIVQVGSNCFR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	34.0081	4.3813	14.5426	149
cluster_2.pdb ( medoid)	26.4158	6.2084	21.8275	164
cluster_3.pdb ( medoid)	23.6082	6.90439	21.6589	163
cluster_4.pdb ( medoid)	20.2674	5.23007	28.797	106
cluster_5.pdb ( medoid)	17.4702	7.95642	23.3015	139
cluster_6.pdb ( medoid)	12.2693	7.09088	16.3448	87
cluster_7.pdb ( medoid)	9.12834	7.01113	22.9539	64
cluster_8.pdb ( medoid)	8.15612	5.63994	12.0126	46
cluster_9.pdb ( medoid)	5.10091	10.1943	21.1793	52
cluster_10.pdb ( medoid)	3.38331	8.86705	17.9105	30