CABS-dock: c3662d30064097

Project name: c3662d30064097

Status: done

submitted: 2026-04-10 15:50:12, status changed: 2026-04-10 17:44:37

Project settings

Protein sequence(s)	KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV input pdb
Peptide sequence	KHMHWHPPALTNT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	40.3168	4.1918	13.4799	169
cluster_2.pdb ( medoid)	24.078	7.89104	29.9038	190
cluster_3.pdb ( medoid)	23.8491	6.58306	18.1889	157
cluster_4.pdb ( medoid)	22.3736	6.70434	14.2915	150
cluster_5.pdb ( medoid)	11.6073	4.3938	15.1584	51
cluster_6.pdb ( medoid)	9.58517	10.1198	28.0163	97
cluster_7.pdb ( medoid)	5.07947	12.206	34.0933	62
cluster_8.pdb ( medoid)	4.5263	11.4884	36.5097	52
cluster_9.pdb ( medoid)	4.02869	10.177	31.3405	41
cluster_10.pdb ( medoid)	3.94924	7.84961	17.2547	31