CABS-dock: 6I2G_ALFA_blind

Project name: 6I2G_ALFA_blind_run1

Status: done

submitted: 2026-07-23 08:53:42, status changed: 2026-07-23 10:38:51

Project settings

Protein sequence(s)	VQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVMVAAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHVLEDRVDSFHDYWGQGTQVTVSS input pdb
Peptide sequence	SRLEEELRRRLTE
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHHHHHHHHHC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	35.5435	3.93884	13.5	140
cluster_2.pdb ( medoid)	24.4157	6.26646	19.7715	153
cluster_3.pdb ( medoid)	24.1157	4.93455	24.5925	119
cluster_4.pdb ( medoid)	19.3577	7.95548	38.3115	154
cluster_5.pdb ( medoid)	12.1931	9.34958	25.2704	114
cluster_6.pdb ( medoid)	10.2958	6.70179	19.4462	69
cluster_7.pdb ( medoid)	7.36501	10.998	37.6228	81
cluster_8.pdb ( medoid)	5.23385	15.2851	33.0724	80
cluster_9.pdb ( medoid)	4.84755	16.2969	40.1142	79
cluster_10.pdb ( medoid)	1.32	8.33336	19.6811	11