Project name: LVTLGARQSSHPVTPGSPMFRYKKRLQLSL_FAPdock

Status: done

submitted: 2025-10-07 22:04:44, status changed: 2025-10-08 03:20:11

Project settings
Protein sequence(s) IQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFS input pdb
Peptide sequence LVTLGARQSSHPVTPGSPMFRYKKRLQLSL
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCCCCEEEEEHHCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 44.2937 2.28023 9.13307 101
cluster_2.pdb ( medoid) 27.0454 3.91934 19.5465 106
cluster_3.pdb ( medoid) 22.4178 7.62788 25.8616 171
cluster_4.pdb ( medoid) 20.933 4.72937 25.3409 99
cluster_5.pdb ( medoid) 19.5158 5.27776 22.5699 103
cluster_6.pdb ( medoid) 11.7397 16.1845 30.5956 190
cluster_7.pdb ( medoid) 6.57998 12.3101 22.1066 81
cluster_8.pdb ( medoid) 5.88116 12.5826 27.7956 74
cluster_9.pdb ( medoid) 4.14904 15.1842 30.155 63
cluster_10.pdb ( medoid) 1.07117 11.2027 22.3846 12