Project name: LepB_3F_2

Status: done

submitted: 2026-06-03 03:09:36, status changed: 2026-06-03 09:48:54

Project settings
Protein sequence(s) RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDGLRLSRIGGIH input pdb
Peptide sequence MLSFAADFFFEGDD
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 40.0241 5.9714 20.1095 239
cluster_2.pdb ( medoid) 22.9571 5.2707 32.2441 121
cluster_3.pdb ( medoid) 22.5449 5.5445 25.9524 125
cluster_4.pdb ( medoid) 15.7881 7.85404 34.9312 124
cluster_5.pdb ( medoid) 12.7137 11.4836 42.9274 146
cluster_6.pdb ( medoid) 10.0894 5.55036 18.5862 56
cluster_7.pdb ( medoid) 7.83092 10.4713 35.109 82
cluster_8.pdb ( medoid) 4.72083 12.0742 42.7268 57
cluster_9.pdb ( medoid) 3.4499 10.4351 24.7631 36
cluster_10.pdb ( medoid) 0.810902 17.2647 31.668 14